TA346087 HPD / PPD antibody

Rabbit Polyclonal Anti-HPD Antibody

See related secondary antibodies

Search for all "HPD / PPD"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish HPD / PPD

TA346087

Product Description for HPD / PPD

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish HPD / PPD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HPD / PPD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 4-hydroxyphenylpyruvate dioxygenase, 4-hydroxyphenylpyruvic acid oxidase, 4HPPD, HPPDase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P32754
Immunogen:
The immunogen for anti-HPD antibody: synthetic peptide directed towards the middle region of human HPD. Synthetic peptide located within the following region: EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV.
GeneID:
3242
Application WB
Background The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HPD / PPD (4 products)

Catalog No. Species Pres. Purity   Source  

HPD / PPD

HPD / PPD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

HPD / PPD (transcript variant 2)

HPD / PPD Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / $299.00
  OriGene Technologies, Inc.

HPD / PPD (1-393, His-tag)

HPD / PPD Human Purified > 90 % E. coli
0.25 mg / $1,070.00
  OriGene Technologies GmbH

HPD / PPD (1-393, His-tag)

HPD / PPD Human Purified > 90 % E. coli
50 µg / $400.00
  OriGene Technologies GmbH

Positive controls for HPD / PPD (2 products)

Catalog No. Species Pres. Purity   Source  

HPD overexpression lysate

HPD overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

HPD overexpression lysate

HPD overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn