TA346058 Uromodulin (UMOD) antibody

Rabbit Polyclonal Anti-UMOD Antibody

See related secondary antibodies

Search for all "Uromodulin (UMOD)"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Uromodulin (UMOD)

Product Description for Uromodulin (UMOD)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Uromodulin (UMOD).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Uromodulin (UMOD)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms THP, Tamm-Horsfall urinary glycoprotein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P07911
Immunogen:
The immunogen for anti-UMOD antibody: synthetic peptide directed towards the middle region of human UMOD. Synthetic peptide located within the following region: MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM.
GeneID:
7369
Application WB
Background This gene encodes uromodulin, the most abundant protein in normal urine. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the lumil cell surface of the lo
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Uromodulin (UMOD) (2 products)

Catalog No. Species Pres. Purity   Source  

Uromodulin (UMOD) (transcript variant 1)

Uromodulin (UMOD) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Uromodulin (UMOD)

Uromodulin (UMOD) Human Purified > 96 % Urine
  BBI Solutions

Positive controls for Uromodulin (UMOD) (2 products)

Catalog No. Species Pres. Purity   Source  

UMOD overexpression lysate

UMOD overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

UMOD overexpression lysate

UMOD overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn