TA346038 SERPINC1 / Antithrombin-III antibody

Rabbit Polyclonal Anti-SERPINC1 Antibody

See related secondary antibodies

Search for all "SERPINC1 / Antithrombin-III"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish SERPINC1 / Antithrombin-III

TA346038

More Views

  • TA346038

Product Description for SERPINC1 / Antithrombin-III

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish SERPINC1 / Antithrombin-III.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SERPINC1 / Antithrombin-III

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AT3, ATIII, Serpin C1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P01008
Immunogen:
The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD.
GeneID:
462
Application WB
IHC
Background The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SERPINC1 / Antithrombin-III (6 products)

Catalog No. Species Pres. Purity   Source  

SERPINC1 / Antithrombin-III

SERPINC1 / Antithrombin-III Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

SERPINC1 / Antithrombin-III (33-464, His-tag)

SERPINC1 / Antithrombin-III Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

SERPINC1 / Antithrombin-III (33-464, His-tag)

SERPINC1 / Antithrombin-III Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

SERPINC1 / Antithrombin-III

SERPINC1 / Antithrombin-III Human Purified Plasma
0.1 mg / $230.00
  OriGene Technologies GmbH

SERPINC1 / Antithrombin-III

SERPINC1 / Antithrombin-III Mouse Purified > 95 % Heparin-Sepharose and anion exchange chromatography Plasma
  OriGene Technologies GmbH

SERPINC1 / Antithrombin-III

SERPINC1 / Antithrombin-III Human > 96 % Plasma
  BBI Solutions
  • LinkedIn