TA345888 SS-A / Ro60 / TROVE antibody

Rabbit Polyclonal Anti-TROVE2 Antibody

See related secondary antibodies

Search for all "SS-A / Ro60 / TROVE"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SS-A / Ro60 / TROVE

TA345888

More Views

  • TA345888

Product Description for SS-A / Ro60 / TROVE

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SS-A / Ro60 / TROVE.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SS-A / Ro60 / TROVE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 60 kDa SS-A/Ro ribonucleoprotein, 60 kDa ribonucleoprotein Ro, Ro 60 kDa autoantigen, RoRNP, SSA2, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10155
Immunogen:
The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS.
GeneID:
6738
Application WB
IHC
Background As a R-binding protein, TROVE2 binds to several small cytoplasmic R molecules known as Y Rs. It may stabilize these Rs from degradation.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SS-A / Ro60 / TROVE (8 products)

Catalog No. Species Pres. Purity   Source  

SS-A / Ro60 / TROVE (transcript variant 3)

SS-A / Ro60 / TROVE Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90.0% as determined by both both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90.0% as determined by both both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90.0% as determined by both both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90 % pure as determined by SDS-PAGE. E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90 % pure as determined by SDS-PAGE. E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90 % pure as determined by SDS-PAGE. E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 96 % Insect cells
  BBI Solutions

Positive controls for SS-A / Ro60 / TROVE (2 products)

Catalog No. Species Pres. Purity   Source  

TROVE2 overexpression lysate

TROVE2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

TROVE2 overexpression lysate

TROVE2 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn