TA345713 SF3B1 / SAP155 antibody

Rabbit Polyclonal Anti-SF3B1 Antibody

See related secondary antibodies

Search for all "SF3B1 / SAP155"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3B1 / SAP155

TA345713

More Views

  • TA345713
  • TA345713
  • TA345713

Product Description for SF3B1 / SAP155

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3B1 / SAP155.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SF3B1 / SAP155

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pre-mRNA-splicing factor SF3b 155 kDa subunit, SAP 155, SAP-155, SF3b155, Spliceosome-associated protein 155, Splicing factor 3B subunit 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75533
Immunogen:
The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the N terminal of human SF3B1. Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR.
GeneID:
23451
Application WB
IHC
Background SF3B1 is subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S R unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mR upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mR. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-termil two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures.This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S R unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mR upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mR. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-termil two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SF3B1 / SAP155 (1 products)

Catalog No. Species Pres. Purity   Source  

SF3B1 / SAP155 (transcript variant 2)

SF3B1 / SAP155 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for SF3B1 / SAP155 (1 products)

Catalog No. Species Pres. Purity   Source  

SF3B1 overexpression lysate

SF3B1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn