TA345699 EXOSC3 antibody

Rabbit Polyclonal Anti-EXOSC3 Antibody

See related secondary antibodies

Search for all "EXOSC3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish EXOSC3

Product Description for EXOSC3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish EXOSC3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EXOSC3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-102, Exosome complex exonuclease RRP40, Exosome component 3, RRP40, Ribosomal RNA-processing protein 40, p10
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQT5
Immunogen:
The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL.
GeneID:
51010
Application WB
Background EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-R to the mature 5.8S rR.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EXOSC3 (4 products)

Catalog No. Species Pres. Purity   Source  

EXOSC3 (transcript variant 1)

EXOSC3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

EXOSC3 (transcript variant 2)

EXOSC3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

EXOSC3 (1-275, His-tag)

EXOSC3 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / $820.00
  OriGene Technologies GmbH

EXOSC3 (1-275, His-tag)

EXOSC3 Human Purified > 85 % by SDS - PAGE E. coli
10 µg / $320.00
  OriGene Technologies GmbH

Positive controls for EXOSC3 (1 products)

Catalog No. Species Pres. Purity   Source  

EXOSC3 overexpression lysate

EXOSC3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn