TA345661 INSIG2 antibody

Rabbit Polyclonal Anti-INSIG1 Antibody

See related secondary antibodies

Search for all "INSIG2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish INSIG2

TA345661

More Views

  • TA345661

Product Description for INSIG2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish INSIG2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for INSIG2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms INSIG-2, Insulin-induced gene 2 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5U4
Immunogen:
The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH.
GeneID:
51141
Application WB
Background Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated sigling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for INSIG2 (1 products)

Catalog No. Species Pres. Purity   Source  

INSIG2

INSIG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn