TA345601 ZNF575 antibody

Rabbit Polyclonal Anti-ZNF575 Antibody

See related secondary antibodies

Search for all "ZNF575"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine ZNF575

Product Description for ZNF575

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine ZNF575.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF575

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 575
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86XF7
Immunogen:
The immunogen for anti-ZNF575 antibody: synthetic peptide directed towards the N terminal of human ZNF575. Synthetic peptide located within the following region: MLERGAESAAGATDPSPTGKEPVTKEAPHQGPPQKPSQSAPGPTASAGSP.
GeneID:
284346
Application WB
Background ZNF575 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn