TA345537 SPIC antibody

Rabbit Polyclonal Anti-SPIC Antibody

See related secondary antibodies

Search for all "SPIC"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine SPIC

Product Description for SPIC

Rabbit anti Bovine, Equine, Human, Porcine SPIC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPIC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transcription factor Spi-C
Presentation Purified
Reactivity Bov, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5J4
Immunogen:
The immunogen for anti-SPIC antibody: synthetic peptide directed towards the middle region of human SPIC. Synthetic peptide located within the following region: LQRLSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHD.
GeneID:
121599
Application WB
Background SPIC controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. SPIC is a transcription factor that binds to the PU-box, a purine-rich D sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. SPIC regulates VCAM1 gene expression.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SPIC (1 products)

Catalog No. Species Pres. Purity   Source  

SPIC (full length, N-term HIS tag)

SPIC Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for SPIC (1 products)

Catalog No. Species Pres. Purity   Source  

SPIC overexpression lysate

SPIC overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn