TA345529 Islet-2 / ISL2 antibody

Rabbit Polyclonal Anti-ISL2 Antibody

See related secondary antibodies

Search for all "Islet-2 / ISL2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Islet-2 / ISL2

Product Description for Islet-2 / ISL2

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Islet-2 / ISL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Islet-2 / ISL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Insulin gene enhancer protein ISL-2
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96A47
Immunogen:
The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the N terminal of human ISL2. Synthetic peptide located within the following region: MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHC.
GeneID:
64843
Application WB
Background ISL2 is the transcriptiol factor that defines subclasses of motoneurons that segregate into columns in the spil cord and select distinct axon pathways.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Islet-2 / ISL2 (1 products)

Catalog No. Species Pres. Purity   Source  

ISL2 overexpression lysate

ISL2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn