TA345516 ZNF498 antibody

Rabbit Polyclonal Anti-ZNF498 Antibody

See related secondary antibodies

Search for all "ZNF498"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human, Rabbit ZNF498

Product Description for ZNF498

Rabbit anti Equine, Human, Rabbit ZNF498.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF498

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger and SCAN domain-containing protein 25, Zinc finger protein 498
Presentation Purified
Reactivity Eq, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NSZ9
Immunogen:
The immunogen for anti-ZNF498 antibody: synthetic peptide directed towards the N terminal of human ZNF498. Synthetic peptide located within the following region: MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRY.
GeneID:
221785
Application WB
Background The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in D binding and protein-protein interactions. Altertive splicing results in two transcript variants encoding different proteins. Additiol splice variants have been identified, but their biological validity has not been determined. This gene encodes a protein that bears some similarity to zinc finger proteins, which are involved in D binding and protein-protein interactions. Multiple altertively spliced transcript variants have been identified, but the full-length ture for most of them has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF498 (1 products)

Catalog No. Species Pres. Purity   Source  

ZSCAN25 overexpression lysate

ZSCAN25 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn