TA345450 SSBP4 antibody

Rabbit Polyclonal Anti-SSBP4 Antibody

See related secondary antibodies

Search for all "SSBP4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish SSBP4

Product Description for SSBP4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish SSBP4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SSBP4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Single-stranded DNA-binding protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BWG4
Immunogen:
The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the C terminal of human SSBP4. Synthetic peptide located within the following region: DGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPFPSESYSPGMTMSV.
GeneID:
170463
Application WB
Background SSBP4 contains 1 LisH domain. The exact function of SSBP4 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SSBP4 (2 products)

Catalog No. Species Pres. Purity   Source  

SSBP4 (transcript variant 1)

SSBP4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

SSBP4 (transcript variant 2)

SSBP4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for SSBP4 (2 products)

Catalog No. Species Pres. Purity   Source  

SSBP4 overexpression lysate

SSBP4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SSBP4 overexpression lysate

SSBP4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn