discontinued

TA345427 SOX7 antibody

Rabbit Polyclonal Anti-SOX7 Antibody

See related secondary antibodies

Search for all "SOX7"

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SOX7

TA345427

More Views

  • TA345427

Product Description for SOX7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SOX7.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SOX7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MGC10895, SRY (sex determining region Y)-box 7, SRY-box 7, Transcription factor SOX-7
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BT81
Immunogen:
The immunogen for anti-SOX7 antibody: synthetic peptide directed towards the N terminal of human SOX7. Synthetic peptide located within the following region: DKGSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALT.
GeneID:
83595
Application WB
IHC
Background SOX7 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determition of the cell fate. SOX7 may act as a transcriptiol regulator after forming a protein complex with other proteins. It may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determition of the cell fate. The encoded protein may act as a transcriptiol regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SOX7 (1 products)

Catalog No. Species Pres. Purity   Source  

SOX7 (full length, N-term HIS tag)

SOX7 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for SOX7 (1 products)

Catalog No. Species Pres. Purity   Source  

SOX7 overexpression lysate

SOX7 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn