TA345269 ZNF307 antibody

Rabbit Polyclonal Anti-ZNF307 Antibody

See related secondary antibodies

Search for all "ZNF307"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZNF307

Product Description for ZNF307

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZNF307.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF307

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms P373c6.1, ZKSCAN4, Zinc finger protein 307, Zinc finger protein with KRAB and SCAN domains 4
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969J2
Immunogen:
The immunogen for anti-ZNF307 antibody: synthetic peptide directed towards the C terminal of human ZNF307. Synthetic peptide located within the following region: FTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ.
GeneID:
387032
Application WB
Background ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF307 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF307

ZNF307 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for ZNF307 (1 products)

Catalog No. Species Pres. Purity   Source  

ZKSCAN4 overexpression lysate

ZKSCAN4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn