TA345189 ZFR antibody

Rabbit Polyclonal Anti-ZFR Antibody

See related secondary antibodies

Search for all "ZFR"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ZFR

Product Description for ZFR

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ZFR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms M-phase phosphoprotein homolog, Zinc finger RNA-binding protein, hZFR
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KR1
Immunogen:
The immunogen for anti-ZFR antibody: synthetic peptide directed towards the C terminal of human ZFR. Synthetic peptide located within the following region: QIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDNF.
GeneID:
51663
Application WB
Background ZFR is critical for Staufen 2 isoform specific nucleocytoplasmic shuttling in neurons.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn