TA345186 TGFB1I1 antibody

Rabbit Polyclonal Anti-TGFB1I1 Antibody

See related secondary antibodies

Search for all "TGFB1I1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat TGFB1I1

TA345186

More Views

  • TA345186

Product Description for TGFB1I1

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat TGFB1I1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TGFB1I1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARA55, Androgen receptor-associated protein of 55 kDa, HIC-5, Hydrogen peroxide-inducible clone 5 protein, Transforming growth factor beta-1-induced transcript 1 protein
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43294
Immunogen:
The immunogen for anti-TGFB1I1 antibody: synthetic peptide directed towards the N terminal of human TGFB1I1. Synthetic peptide located within the following region: PRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRS.
GeneID:
7041
Application WB
IHC
Background The TGFB1I1 gene encodes a protein that is a key element in the transduction of sigls from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TGFB1I1 (2 products)

Catalog No. Species Pres. Purity   Source  

TGFB1I1 (transcript variant 2)

TGFB1I1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

TGFB1I1 (transcript variant 3)

TGFB1I1 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn