TA345163 Septin-2 antibody

Rabbit Polyclonal Anti-SEPT2 Antibody

See related secondary antibodies

Search for all "Septin-2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Septin-2

Product Description for Septin-2

Rabbit anti Septin-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Septin-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DIFF6, KIAA0158, NEDD-5, NEDD5, Neural precursor cell expressed developmentally down-regulated protein 5, SEPT-2, SEPT2, Septin2
Presentation Purified
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15019
Immunogen:
The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the middle region of human SEPT2. Synthetic peptide located within the following region: LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI.
GeneID:
4735
Application WB
Background SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Septin-2 (5 products)

Catalog No. Species Pres. Purity   Source  

Septin-2 (transcript variant 4)

Septin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Septin-2 (transcript variant 2)

Septin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Septin-2 (transcript variant 3)

Septin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Septin-2 (1-361, His-tag)

Recombinant human SEPT2, 1-361 aa, His-tagged Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / $820.00
  OriGene Technologies GmbH

Septin-2 (1-361, His-tag)

Recombinant human SEPT2, 1-361 aa, His-tagged Human Purified > 90 % by SDS - PAGE E. coli
50 µg / $320.00
  OriGene Technologies GmbH

Positive controls for Septin-2 (7 products)

Catalog No. Species Pres. Purity   Source  

SEPT2 overexpression lysate

SEPT2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SEPT2 overexpression lysate

SEPT2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SEPT2 overexpression lysate

SEPT2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SEPT2 overexpression lysate

SEPT2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SEPT2 overexpression lysate

SEPT2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SEPT2 overexpression lysate

SEPT2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

SEPT2 overexpression lysate

SEPT2 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn