TA345156 PFKFB2 antibody

Rabbit Polyclonal Anti-PFKFB2 Antibody - C-terminal region

See related secondary antibodies

Search for all "PFKFB2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PFKFB2

Product Description for PFKFB2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PFKFB2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PFKFB2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 6-biphosphatase 2, 6-phosphofructo-2-kinase/fructose-2, PFK-2/FBPase-2, PFK/FBPase 2, PFKFB cardiac
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60825
Immunogen:
The immunogen for anti-Pfkfb2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ.
GeneID:
5208
Application WB
Background Synthesis and degradation of fructose 2,6-bisphosphate.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PFKFB2 (1 products)

Catalog No. Species Pres. Purity   Source  

PFKFB2 (N-term HIS tag, transcript variant 1)

PFKFB2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for PFKFB2 (2 products)

Catalog No. Species Pres. Purity   Source  

PFKFB2 overexpression lysate

PFKFB2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

PFKFB2 overexpression lysate

PFKFB2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn