TA345152 PHYH / PAHX antibody

Rabbit Polyclonal Anti-PHYH Antibody - N-terminal region

See related secondary antibodies

Search for all "PHYH / PAHX"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Mouse, Porcine, Zebrafish PHYH / PAHX

Product Description for PHYH / PAHX

Rabbit anti Human, Mouse, Porcine, Zebrafish PHYH / PAHX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PHYH / PAHX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Phytanic acid oxidase, Phytanoyl-CoA alpha-hydroxylase, Phytanoyl-CoA dioxygenase peroxisomal
Presentation Purified
Reactivity Hu, Ms, Por, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14832
Immunogen:
The immunogen for anti-PHYH antibody: synthetic peptide directed towards the N terminal of human PHYH. Synthetic peptide located within the following region: TLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFR.
GeneID:
5264
Application WB
Background This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have been associated with Refsum disease (RD) and deficient protein activity has been associated with Zellweger syndrome and rhizomelic chondrodysplasia punctata. Alterte transcriptiol splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PHYH / PAHX (1 products)

Catalog No. Species Pres. Purity   Source  

PHYH / PAHX (transcript variant 1)

PHYH / PAHX Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for PHYH / PAHX (2 products)

Catalog No. Species Pres. Purity   Source  

PHYH overexpression lysate

PHYH overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

PHYH overexpression lysate

PHYH overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn