TA345132 PSMC4 / TBP7 antibody

Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region

See related secondary antibodies

Search for all "PSMC4 / TBP7"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human, Mouse, Rabbit, Zebrafish PSMC4 / TBP7

TA345132

More Views

  • TA345132

Product Description for PSMC4 / TBP7

Rabbit anti Equine, Human, Mouse, Rabbit, Zebrafish PSMC4 / TBP7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PSMC4 / TBP7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 26S protease regulatory subunit 6B, MB67-interacting protein, MIP224, Proteasome 26S subunit ATPase 4, TBP-7, Tat-binding protein 7
Presentation Purified
Reactivity Eq, Hu, Ms, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43686
Immunogen:
The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE.
GeneID:
5704
Application WB
Background The 26S proteasome is a multicatalytic proteise complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMC4 / TBP7 (1 products)

Catalog No. Species Pres. Purity   Source  

PSMC4 / TBP7 (transcript variant 1)

PSMC4 / TBP7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for PSMC4 / TBP7 (1 products)

Catalog No. Species Pres. Purity   Source  

PSMC4 overexpression lysate

PSMC4 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn