TA345131 Relaxin 1 / RLN1 antibody

Rabbit Polyclonal Anti-RLN1 Antibody - middle region

See related secondary antibodies

Search for all "Relaxin 1 / RLN1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human Relaxin 1 / RLN1

Product Description for Relaxin 1 / RLN1

Rabbit anti Human Relaxin 1 / RLN1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Relaxin 1 / RLN1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pro-Relaxin 1, Prorelaxin H1, RLXH1, Relaxin A chain, Relaxin B chain, Relaxin H1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P04808
Immunogen:
The immunogen for anti-RLN1 antibody: synthetic peptide directed towards the middle region of human RLN1. Synthetic peptide located within the following region: EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK.
GeneID:
6013
Application WB
Background Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In humans there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3, where RLN1 and RLN2 share high sequence homology. The protein encoded by this gene is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additiol roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. [provided by RefSeq, Jan 2013].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Relaxin 1 / RLN1 (1 products)

Catalog No. Species Pres. Purity   Source  

RLN1 overexpression lysate

RLN1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn