TA345128 RPE antibody

Rabbit Polyclonal Anti-RPE Antibody - N-terminal region

See related secondary antibodies

Search for all "RPE"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish RPE

TA345128

More Views

  • TA345128

Product Description for RPE

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish RPE.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HUSSY-17, Ribulose-5-phosphate-3-epimerase, Ribulose-phosphate 3-epimerase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96AT9
Immunogen:
The immunogen for anti-RPE antibody: synthetic peptide directed towards the N terminal of human RPE. Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ.
GeneID:
6120
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPE (3 products)

Catalog No. Species Pres. Purity   Source  

RPE (transcript variant 1)

RPE Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

RPE (1-228, His-tag)

RPE Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

RPE (1-228, His-tag)

RPE Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for RPE (1 products)

Catalog No. Species Pres. Purity   Source  

RPE overexpression lysate

RPE overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn