UBL3 / MUB

Product Description for UBL3 / MUB

Rabbit anti Human, Mouse UBL3 / MUB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	Membrane-anchored ubiquitin-fold protein, PNSC1, Protein HCG-1, Ubiquitin-like protein 3
Presentation	Purified
Reactivity	Hu, Ms
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: O95164 Immunogen: The immunogen for Anti-Ubl3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ubl3. Synthetic peptide located within the following region: VPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSS. GeneID: 5412
Application	WB
Background	The function of this protein remains unknown.
Format	Purification: Affinity Purified Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP308453	UBL3 / MUB
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / $748.00
					OriGene Technologies, Inc.
AR39021PU-L	UBL3 / MUB (1-114, His-tag)
	Human	Purified	> 90 %	E. coli	0.5 mg / $820.00
					OriGene Technologies GmbH
AR39021PU-N	UBL3 / MUB (1-114, His-tag)
	Human	Purified	> 90 %	E. coli	0.1 mg / $320.00
					OriGene Technologies GmbH

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH