TA345105 UBXN1 / SAKS1 antibody

Rabbit Polyclonal Anti-UBXN1 Antibody - middle region

See related secondary antibodies

Search for all "UBXN1 / SAKS1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Rat UBXN1 / SAKS1

Product Description for UBXN1 / SAKS1

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Rat UBXN1 / SAKS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBXN1 / SAKS1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SAPK substrate protein 1, UBA/UBX 33.3 kDa protein, UBX domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, GP, Gt, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q04323-2
Immunogen:
The immunogen for anti-UBXN1 antibody: synthetic peptide directed towards the middle region of human LOC51035. Synthetic peptide located within the following region: RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF.
GeneID:
51035
Application WB
Background Ubiquitin-binding protein that interacts with the BRCA1-BARD1 heterodimer, and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitited BRCA1, leads to inhibit the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn