TA345082 FAM108B1 antibody

Rabbit Polyclonal Anti-FAM108B1 Antibody - middle region

See related secondary antibodies

Search for all "FAM108B1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Porcine, Rabbit, Zebrafish FAM108B1

Product Description for FAM108B1

Rabbit anti Bovine, Canine, Porcine, Rabbit, Zebrafish FAM108B1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM108B1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Abhydrolase domain-containing protein FAM108B1, C9orf77, CGI-67, chromosome 9 open reading frame 77
Presentation Purified
Reactivity Bov, Can, Por, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VST6
Immunogen:
The immunogen for anti-FAM108B1 antibody: synthetic peptide directed towards the middle region of human FAM108B1. Synthetic peptide located within the following region: SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY.
GeneID:
51104
Application WB
Background FAM108B1 belongs to the AB hydrolase superfamily.fAM108 family. The exact function of FAM108B1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM108B1 (1 products)

Catalog No. Species Pres. Purity   Source  

FAM108B1 (transcript variant 1)

FAM108B1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for FAM108B1 (1 products)

Catalog No. Species Pres. Purity   Source  

ABHD17B overexpression lysate

ABHD17B overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn