TA345075 MRPL48 antibody

Rabbit Polyclonal Anti-Mrpl48 Antibody - C-terminal region

See related secondary antibodies

Search for all "MRPL48"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Rat MRPL48

Product Description for MRPL48

Rabbit anti Human, Rat MRPL48.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRPL48

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 39S ribosomal protein L48, CGI-118, HSPC290, L48mt, MRP-L48, mitochondrial
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GC5
Immunogen:
The immunogen for Anti-Mrpl48 antibody is: synthetic peptide directed towards the C-terminal region of Rat Mrpl48. Synthetic peptide located within the following region: ISGLSATFAEIFLEILQINLPEGVRLSVREHTEEDFKGRFKARPELEELL.
GeneID:
51642
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRPL48 (3 products)

Catalog No. Species Pres. Purity   Source  

MRPL48 (full length, N-term HIS tag)

MRPL48 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

MRPL48 (29-212, His-tag)

MRPL48 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

MRPL48 (29-212, His-tag)

MRPL48 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn