TA344997 UCHL5IP / HAUS7 antibody

Rabbit Polyclonal Anti-UCHL5IP Antibody - middle region

See related secondary antibodies

Search for all "UCHL5IP / HAUS7"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human UCHL5IP / HAUS7

Product Description for UCHL5IP / HAUS7

Rabbit anti Human UCHL5IP / HAUS7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UCHL5IP / HAUS7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 26S proteasome-associated UCH37-interacting protein 1, HAUS augmin-like complex subunit 7, UCHL5-interacting protein, UIP1, X-linked protein STS1769
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99871
Immunogen:
The immunogen for anti-UCHL5IP antibody: synthetic peptide directed towards the middle region of human UCHL5IP. Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC.
GeneID:
55559
Application WB
Background This gene encodes a protein identified by interaction with ubiquitin C-termil hydrolase 37, which functions to edit polyubiquitin chains on ubiquitited substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UCHL5IP / HAUS7 (1 products)

Catalog No. Species Pres. Purity   Source  

UCHL5IP / HAUS7 (transcript variant 1)

UCHL5IP / HAUS7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for UCHL5IP / HAUS7 (1 products)

Catalog No. Species Pres. Purity   Source  

HAUS7 overexpression lysate

HAUS7 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn