TA344974 BIVM antibody

Rabbit Polyclonal Anti-BIVM Antibody - middle region

See related secondary antibodies

Search for all "BIVM"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Mouse, Porcine BIVM

Product Description for BIVM

Rabbit anti Human, Mouse, Porcine BIVM.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BIVM

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Basic immunoglobulin-like variable motif-containing protein
Presentation Purified
Reactivity Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UB2
Immunogen:
The immunogen for anti-BIVM antibody: synthetic peptide directed towards the middle region of human BIVM. Synthetic peptide located within the following region: PFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK.
GeneID:
54841
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for BIVM (1 products)

Catalog No. Species Pres. Purity   Source  

BIVM overexpression lysate

BIVM overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn