TA344958 NALP2 antibody

Rabbit Polyclonal Anti-NLRP2 Antibody - C-terminal region

See related secondary antibodies

Search for all "NALP2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human NALP2

Product Description for NALP2

Rabbit anti Human NALP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NALP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LRR and PYD domains-containing protein 2, NACHT, NBS1, NLRP2, PAN1, PYPAF2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NX02
Immunogen:
The immunogen for anti-NLRP2 antibody: synthetic peptide directed towards the C terminal of human NLRP2. Synthetic peptide located within the following region: FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA.
GeneID:
55655
Application WB
Background LP proteins, such as LP2, are characterized by an N-termil pyrin (MIM 608107) domain (PYD) and are involved in the activation of caspase-1 (CASP1; MIM 147678) by Toll-like receptors (see TLR4; MIM 603030). They may also be involved in protein complexes that activate proinflammatory caspases (Tschopp et al., 2003 [PubMed 12563287]).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NALP2 (1 products)

Catalog No. Species Pres. Purity   Source  

NALP2

NALP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $788.00
  OriGene Technologies, Inc.

Positive controls for NALP2 (1 products)

Catalog No. Species Pres. Purity   Source  

NLRP2 overexpression lysate

NLRP2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn