TA344932 GPN2 / ATPBD1B antibody

Rabbit Polyclonal Anti-GPN2 Antibody - middle region

See related secondary antibodies

Search for all "GPN2 / ATPBD1B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GPN2 / ATPBD1B

Product Description for GPN2 / ATPBD1B

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GPN2 / ATPBD1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPN2 / ATPBD1B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-binding domain 1 family member B, GPN-loop GTPase 2
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H9Y4
Immunogen:
The immunogen for anti-GPN2 antibody: synthetic peptide directed towards the middle region of human GPN2. Synthetic peptide located within the following region: VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN.
GeneID:
54707
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GPN2 / ATPBD1B (1 products)

Catalog No. Species Pres. Purity   Source  

GPN2 / ATPBD1B

GPN2 / ATPBD1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for GPN2 / ATPBD1B (1 products)

Catalog No. Species Pres. Purity   Source  

GPN2 overexpression lysate

GPN2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn