TA344918 ARL8B / ARL10C antibody

Rabbit Polyclonal Anti-ARL8B Antibody - middle region

See related secondary antibodies

Search for all "ARL8B / ARL10C"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish ARL8B / ARL10C

Product Description for ARL8B / ARL10C

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish ARL8B / ARL10C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARL8B / ARL10C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylation factor-like protein 10C, ADP-ribosylation factor-like protein 8B, GIE1, Novel small G protein indispensable for equal chromosome segregation 1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVJ2
Immunogen:
The immunogen for anti-ARL8B antibody: synthetic peptide directed towards the middle region of human ARL8B. Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL.
GeneID:
55207
Application WB
Background ARL8B may play a role in lysosome motility and chromosome segregation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARL8B / ARL10C (1 products)

Catalog No. Species Pres. Purity   Source  

ARL8B / ARL10C

ARL8B / ARL10C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn