TA344907 PNMAL1 antibody

Rabbit Polyclonal Anti-PNMAL1 Antibody - middle region

See related secondary antibodies

Search for all "PNMAL1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human PNMAL1

Product Description for PNMAL1

Rabbit anti Human PNMAL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PNMAL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PNMA-like protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86V59
Immunogen:
The immunogen for anti-PNMAL1 antibody: synthetic peptide directed towards the middle region of human PNMAL1. Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ.
GeneID:
55228
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for PNMAL1 (2 products)

Catalog No. Species Pres. Purity   Source  

PNMAL1 overexpression lysate

PNMAL1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

PNMAL1 overexpression lysate

PNMAL1 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn