TA344905 PANK4 antibody

Rabbit Polyclonal Anti-PANK4 Antibody - middle region

See related secondary antibodies

Search for all "PANK4"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish PANK4

Product Description for PANK4

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish PANK4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PANK4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DKFZp547M242, FLJ10782, Pantothenate kinase 4, Pantothenic acid kinase 4
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVE7
Immunogen:
The immunogen for anti-PANK4 antibody: synthetic peptide directed towards the middle region of human PANK4. Synthetic peptide located within the following region: LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD.
GeneID:
55229
Application WB
Background This gene encodes a protein belonging to the pantothete kise family. Pantothete kise is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn