TA344886 VPS53 antibody

Rabbit Polyclonal Anti-VPS53 Antibody - middle region

See related secondary antibodies

Search for all "VPS53"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish VPS53

Product Description for VPS53

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish VPS53.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VPS53

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PP13624, Vacuolar protein sorting-associated protein 53 homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VIR6
Immunogen:
The immunogen for anti-VPS53 antibody: synthetic peptide directed towards the middle region of human VPS53. Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK.
GeneID:
55275
Application WB
Background This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for VPS53 (1 products)

Catalog No. Species Pres. Purity   Source  

VPS53 (transcript variant 1)

VPS53 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn