TA344879 BXDC2 antibody

Rabbit Polyclonal Anti-BXDC2 Antibody - middle region

See related secondary antibodies

Search for all "BXDC2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Zebrafish BXDC2

Product Description for BXDC2

Rabbit anti Human, Zebrafish BXDC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BXDC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brix domain-containing protein 2, Ribosome biogenesis protein Brix
Presentation Purified
Reactivity Hu, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TDN6
Immunogen:
The immunogen for anti-BXDC2 antibody: synthetic peptide directed towards the middle region of human BXDC2. Synthetic peptide located within the following region: IWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNM.
GeneID:
55299
Application WB
Background BXDC2 is required for biogenesis of the 60S ribosomal subunit.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for BXDC2 (1 products)

Catalog No. Species Pres. Purity   Source  

BRIX1 overexpression lysate

BRIX1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn