TA344865 NHSL1 antibody

Rabbit Polyclonal Anti-NHSL1 Antibody - middle region

See related secondary antibodies

Search for all "NHSL1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit NHSL1

Product Description for NHSL1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit NHSL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NHSL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf63, KIAA1357, NHS-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SYE7
Immunogen:
The immunogen for anti-MNS1 antibody: synthetic peptide directed towards the middle region of human MNS1. Synthetic peptide located within the following region: KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL.
GeneID:
57224
Application WB
Background This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuc
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for NHSL1 (1 products)

Catalog No. Species Pres. Purity   Source  

NHSL1 overexpression lysate

NHSL1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn