TA344845 NOLA3 antibody

Rabbit Polyclonal Anti-NOLA3 Antibody - middle region

See related secondary antibodies

Search for all "NOLA3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human NOLA3

Product Description for NOLA3

Rabbit anti Human NOLA3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NOLA3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms H/ACA ribonucleoprotein complex subunit 3, NOP10
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NPE3
Immunogen:
The immunogen for anti-NOLA3 antibody: synthetic peptide directed towards the middle region of human NOLA3. Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK.
GeneID:
55505
Application WB
Background This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rR processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NOLA3 (1 products)

Catalog No. Species Pres. Purity   Source  

NOLA3 (full length, N-term HIS tag)

NOLA3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for NOLA3 (1 products)

Catalog No. Species Pres. Purity   Source  

NOP10 overexpression lysate

NOP10 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn