TA344828 SASH3 antibody

Rabbit Polyclonal Anti-CXorf9 Antibody - C-terminal region

See related secondary antibodies

Search for all "SASH3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human SASH3

Product Description for SASH3

Rabbit anti Human SASH3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SASH3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CXorf9, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SLY
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75995
Immunogen:
The immunogen for anti-CXorf9 antibody: synthetic peptide directed towards the C terminal of human CXorf9. Synthetic peptide located within the following region: RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET.
GeneID:
54440
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SASH3 (1 products)

Catalog No. Species Pres. Purity   Source  

SASH3

SASH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for SASH3 (1 products)

Catalog No. Species Pres. Purity   Source  

SASH3 overexpression lysate

SASH3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn