TA344810 Follistatin-like protein 5 antibody

Rabbit Polyclonal Anti-FSTL5 Antibody - middle region

See related secondary antibodies

Search for all "Follistatin-like protein 5"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Mouse, Rabbit, Rat, Zebrafish Follistatin-like protein 5

Product Description for Follistatin-like protein 5

Rabbit anti Human, Mouse, Rabbit, Rat, Zebrafish Follistatin-like protein 5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Follistatin-like protein 5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FSTL5, Follistatin-related protein 5, KIAA1263
Presentation Purified
Reactivity Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N475
Immunogen:
The immunogen for anti-FSTL5 antibody: synthetic peptide directed towards the middle region of human FSTL5. Synthetic peptide located within the following region: NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD.
GeneID:
56884
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Follistatin-like protein 5 (1 products)

Catalog No. Species Pres. Purity   Source  

FSTL5 overexpression lysate

FSTL5 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn