TA344805 FEM1C / FEM1-gamma antibody

Rabbit Polyclonal Anti-FEM1C Antibody - C-terminal region

See related secondary antibodies

Search for all "FEM1C / FEM1-gamma"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Rat FEM1C / FEM1-gamma

Product Description for FEM1C / FEM1-gamma

Rabbit anti Human, Rat FEM1C / FEM1-gamma.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FEM1C / FEM1-gamma

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1785, Protein fem-1 homolog C
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JP0
Immunogen:
The immunogen for Anti-Fem1c antibody is: synthetic peptide directed towards the C-terminal region of Rat Fem1c. Synthetic peptide located within the following region: LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK.
GeneID:
56929
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FEM1C / FEM1-gamma (1 products)

Catalog No. Species Pres. Purity   Source  

FEM1C overexpression lysate

FEM1C overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn