TA344804 C16orf61 antibody

Rabbit Polyclonal Anti-C16orf61 Antibody - middle region

See related secondary antibodies

Search for all "C16orf61"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human C16orf61

Product Description for C16orf61

Rabbit anti Human C16orf61.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C16orf61

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DC13, Uncharacterized protein C16orf61
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRP2
Immunogen:
The immunogen for anti-C16orf61 antibody: synthetic peptide directed towards the middle region of human C16orf61. Synthetic peptide located within the following region: NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE.
GeneID:
56942
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C16orf61 (1 products)

Catalog No. Species Pres. Purity   Source  

CMC2 overexpression lysate

CMC2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn