TA344774 C11orf16 antibody

Rabbit Polyclonal Anti-C11orf16 Antibody - middle region

See related secondary antibodies

Search for all "C11orf16"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human C11orf16

Product Description for C11orf16

Rabbit anti Human C11orf16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C11orf16

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C11orf16
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ32
Immunogen:
The immunogen for anti-C11orf16 antibody: synthetic peptide directed towards the middle region of human C11orf16. Synthetic peptide located within the following region: EPCLGKPGTRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTP.
GeneID:
56673
Application WB
Background The function of C11orf16 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C11orf16 (1 products)

Catalog No. Species Pres. Purity   Source  

C11orf16 overexpression lysate

C11orf16 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn