TA344770 TBC1D24 antibody

Rabbit Polyclonal Anti-TBC1D24 Antibody - middle region

See related secondary antibodies

Search for all "TBC1D24"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Rabbit, Rat TBC1D24

Product Description for TBC1D24

Rabbit anti Equine, Guinea Pig, Human, Rabbit, Rat TBC1D24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TBC1D24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1171, TBC1 domain family member 24
Presentation Purified
Reactivity Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULP9
Immunogen:
The immunogen for anti-TBC1D24 antibody: synthetic peptide directed towards the middle region of human TBC1D24. Synthetic peptide located within the following region: SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL.
GeneID:
57465
Application WB
Background TBC1D24 may act as a GTPase-activating protein for Rab family protein(s).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TBC1D24 (1 products)

Catalog No. Species Pres. Purity   Source  

TBC1D24

TBC1D24 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for TBC1D24 (1 products)

Catalog No. Species Pres. Purity   Source  

TBC1D24 overexpression lysate

TBC1D24 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn