TA344763 PDP2 antibody

Rabbit Polyclonal Anti-PDP2 Antibody

See related secondary antibodies

Search for all "PDP2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat PDP2

Product Description for PDP2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat PDP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1348, PDP 2, PDPC 2, Pyruvate dehydrogenase acetyl-transferring-phosphatase 2 mitochondrial, Pyruvate dehydrogenase phosphatase catalytic subunit 2, Pyruvate dehydrogenase phosphatase isoenzyme 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2J9
Immunogen:
The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED.
GeneID:
57546
Application WB
Background PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogese complex.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDP2 (1 products)

Catalog No. Species Pres. Purity   Source  

PDP2

PDP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn