TA344759 ARHGAP20 antibody

Rabbit Polyclonal Anti-ARHGAP20 Antibody

See related secondary antibodies

Search for all "ARHGAP20"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit ARHGAP20

Product Description for ARHGAP20

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit ARHGAP20.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARHGAP20

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1391, Rho GTPase-activating protein 20, Rho-type GTPase-activating protein 20
Presentation Purified
Reactivity Bov, Can, Eq, GP, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2F6
Immunogen:
The immunogen for anti-ARHGAP20 antibody: synthetic peptide directed towards the middle region of human ARHGAP20. Synthetic peptide located within the following region: YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK.
GeneID:
57569
Application WB
Background ARHGAP20 is an GTPase activator for the Rho-type GTPases by converting them to an ictive GDP-bound state.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ARHGAP20 (1 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP20 overexpression lysate

ARHGAP20 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn