TA344744 Bcl-7A antibody

Rabbit Polyclonal Anti-BCL7A Antibody

See related secondary antibodies

Search for all "Bcl-7A"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Zebrafish Bcl-7A

TA344744

More Views

  • TA344744
  • TA344744

Product Description for Bcl-7A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Zebrafish Bcl-7A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Bcl-7A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B-cell CLL/lymphoma 7 protein family member A, BCL7A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4VC05
Immunogen:
The immunogen for anti-BCL7A antibody: synthetic peptide directed towards the middle region of human BCL7A. Synthetic peptide located within the following region: CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN.
GeneID:
605
Application WB
Background This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-termil region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-termil segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-7A (3 products)

Catalog No. Species Pres. Purity   Source  

Bcl-7A (transcript variant 2)

Bcl-7A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Bcl-7A (1-210, His-tag)

Bcl-7A Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $820.00
  OriGene Technologies GmbH

Bcl-7A (1-210, His-tag)

Bcl-7A Human Purified > 85 % by SDS - PAGE E. coli
20 µg / $320.00
  OriGene Technologies GmbH

Positive controls for Bcl-7A (1 products)

Catalog No. Species Pres. Purity   Source  

BCL7A overexpression lysate

BCL7A overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn