TA344736 TRIB3 antibody

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

See related secondary antibodies

Search for all "TRIB3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human TRIB3

Product Description for TRIB3

Rabbit anti Human TRIB3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIB3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NIPK, SKIP3, TRB-3, TRB3, Tribbles homolog 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96RU7
Immunogen:
The immunogen for Anti-TRIB3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRIB3. Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV.
GeneID:
57761
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIB3 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIB3 (1-358, His-tag)

TRIB3 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / $820.00
  OriGene Technologies GmbH

TRIB3 (1-358, His-tag)

TRIB3 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / $320.00
  OriGene Technologies GmbH

Positive controls for TRIB3 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIB3 overexpression lysate

TRIB3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn