TA344728 TRAPPC1 antibody

Rabbit Polyclonal Anti-TRAPPC1 Antibody - middle region

See related secondary antibodies

Search for all "TRAPPC1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Mouse, Rat, Zebrafish TRAPPC1

Product Description for TRAPPC1

Rabbit anti Canine, Mouse, Rat, Zebrafish TRAPPC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRAPPC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BET5, MUM-2, MUM2, Multiple myeloma protein 2, Trafficking protein particle complex subunit 1
Presentation Purified
Reactivity Can, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5R8
Immunogen:
The immunogen for anti-TRAPPC1 antibody: synthetic peptide directed towards the middle region of human TRAPPC1. Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM.
GeneID:
58485
Application WB
Background This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Altertive splicing results in multiple transcript variants.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRAPPC1 (1 products)

Catalog No. Species Pres. Purity   Source  

TRAPPC1

TRAPPC1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for TRAPPC1 (2 products)

Catalog No. Species Pres. Purity   Source  

TRAPPC1 overexpression lysate

TRAPPC1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

TRAPPC1 overexpression lysate

TRAPPC1 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn