RPRD1B

Product Description for RPRD1B

Rabbit anti Human, Mouse RPRD1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	C20orf77, CREPT, Cell cycle-related and expression-elevated protein in tumor, Regulation of nuclear pre-mRNA domain-containing protein 1B, chromosome 20 open reading frame 77
Presentation	Purified
Reactivity	Hu, Ms
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q9NQG5 Immunogen: The immunogen for Anti-Rprd1b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rprd1b. Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY. GeneID: 58490
Application	WB
Background	Rprd1b interacts with phosphorylated C-termil heptapeptide repeat domain (CTD) of the largest R polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptiol regulator which enhances expression of CCND1. It promotes binding of R polymerase II to the CCDN1 promoter and to the termition region before the poly-A site but decreases its binding after the poly-A site. It prevents R polymerase II from reading through the 3' end termition site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. It also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Rprd1b promotes cell proliferation.
Format	Purification: Affinity Purified Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP307481	RPRD1B
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / $748.00
					OriGene Technologies, Inc.
AR51868PU-N	RPRD1B (1-326, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	0.5 mg / $820.00
					OriGene Technologies GmbH
AR51868PU-S	RPRD1B (1-326, His-tag)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	0.1 mg / $320.00
					OriGene Technologies GmbH

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH