TA344696 PRSS22 antibody

Rabbit Polyclonal Anti-PRSS22 Antibody - N-terminal region

See related secondary antibodies

Search for all "PRSS22"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Guinea Pig, Mouse, Rat PRSS22

Product Description for PRSS22

Rabbit anti Canine, Guinea Pig, Mouse, Rat PRSS22.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRSS22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BSSP-4, BSSP4, Brain-specific serine protease 4, PRSS26, Serine protease 22, Serine protease 26, Tryptase epsilon
Presentation Purified
Reactivity Can, GP, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZN4
Immunogen:
The immunogen for anti-PRSS22 antibody: synthetic peptide directed towards the N terminal of human PRSS22. Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW.
GeneID:
64063
Application WB
Background This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for PRSS22 (1 products)

Catalog No. Species Pres. Purity   Source  

PRSS22 overexpression lysate

PRSS22 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn